Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213

  1. Avatar for jamiexq 101. jamiexq Lv 1 17 pts. 9,720
  2. Avatar for Arne Heessels 102. Arne Heessels Lv 1 17 pts. 9,719
  3. Avatar for WolverineX 103. WolverineX Lv 1 17 pts. 9,718
  4. Avatar for rezaefar 104. rezaefar Lv 1 16 pts. 9,707
  5. Avatar for kevin everington 105. kevin everington Lv 1 16 pts. 9,702
  6. Avatar for evgeniy.g.abramov 106. evgeniy.g.abramov Lv 1 16 pts. 9,698
  7. Avatar for Caraline_nelson 107. Caraline_nelson Lv 1 15 pts. 9,692
  8. Avatar for harvardman 108. harvardman Lv 1 15 pts. 9,663
  9. Avatar for navn 109. navn Lv 1 15 pts. 9,661
  10. Avatar for andrewxc 110. andrewxc Lv 1 14 pts. 9,660

Comments