Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213

  1. Avatar for MrZanav 111. MrZanav Lv 1 14 pts. 9,654
  2. Avatar for Kerzzel 112. Kerzzel Lv 1 14 pts. 9,644
  3. Avatar for CAN1958 113. CAN1958 Lv 1 13 pts. 9,641
  4. Avatar for marp 114. marp Lv 1 13 pts. 9,641
  5. Avatar for EagleGuy 115. EagleGuy Lv 1 13 pts. 9,622
  6. Avatar for fluttersome 116. fluttersome Lv 1 13 pts. 9,613
  7. Avatar for pascal ochem 117. pascal ochem Lv 1 12 pts. 9,593
  8. Avatar for frostschutz 118. frostschutz Lv 1 12 pts. 9,588
  9. Avatar for Hellcat6 119. Hellcat6 Lv 1 12 pts. 9,566
  10. Avatar for Trajan464 120. Trajan464 Lv 1 12 pts. 9,562

Comments