Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for marfo 151. marfo Lv 1 6 pts. 9,304
  2. Avatar for TremendoAfro 152. TremendoAfro Lv 1 5 pts. 9,294
  3. Avatar for hajtogato 153. hajtogato Lv 1 5 pts. 9,288
  4. Avatar for xythus 154. xythus Lv 1 5 pts. 9,287
  5. Avatar for gifeme 155. gifeme Lv 1 5 pts. 9,286
  6. Avatar for whistle1313 156. whistle1313 Lv 1 5 pts. 9,283
  7. Avatar for cebt103320058 157. cebt103320058 Lv 1 5 pts. 9,280
  8. Avatar for justinchiang 158. justinchiang Lv 1 5 pts. 9,251
  9. Avatar for keiner 159. keiner Lv 1 5 pts. 9,232
  10. Avatar for Enrico Vincenzi 160. Enrico Vincenzi Lv 1 4 pts. 9,227

Comments