Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for Zerg539 171. Zerg539 Lv 1 3 pts. 9,158
  2. Avatar for cjp 172. cjp Lv 1 3 pts. 9,156
  3. Avatar for justjustin 173. justjustin Lv 1 3 pts. 9,155
  4. Avatar for houbi 174. houbi Lv 1 3 pts. 9,155
  5. Avatar for chimpaznee 175. chimpaznee Lv 1 3 pts. 9,153
  6. Avatar for YellowBearPL 176. YellowBearPL Lv 1 3 pts. 9,140
  7. Avatar for Arthemian 177. Arthemian Lv 1 3 pts. 9,139
  8. Avatar for kzkm 178. kzkm Lv 1 3 pts. 9,134
  9. Avatar for Kahelthalas 179. Kahelthalas Lv 1 3 pts. 9,129
  10. Avatar for dudeman1st 180. dudeman1st Lv 1 3 pts. 9,128

Comments