Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for grogar7 11. grogar7 Lv 1 86 pts. 10,689
  2. Avatar for mirp 12. mirp Lv 1 85 pts. 10,688
  3. Avatar for 181818 13. 181818 Lv 1 84 pts. 10,662
  4. Avatar for johnmitch 14. johnmitch Lv 1 82 pts. 10,628
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 81 pts. 10,612
  6. Avatar for silent gene 16. silent gene Lv 1 80 pts. 10,597
  7. Avatar for SileNTViP 17. SileNTViP Lv 1 79 pts. 10,588
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 78 pts. 10,576
  9. Avatar for nicobul 19. nicobul Lv 1 76 pts. 10,550
  10. Avatar for phi16 20. phi16 Lv 1 75 pts. 10,545

Comments