Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for This name is already taken 191. This name is already taken Lv 1 2 pts. 9,069
  2. Avatar for KennyMcCornick 192. KennyMcCornick Lv 1 2 pts. 9,069
  3. Avatar for donglsci 193. donglsci Lv 1 2 pts. 9,067
  4. Avatar for porrada 194. porrada Lv 1 2 pts. 9,065
  5. Avatar for RAN_5k 195. RAN_5k Lv 1 2 pts. 9,046
  6. Avatar for allyb 196. allyb Lv 1 2 pts. 9,035
  7. Avatar for grw0009 197. grw0009 Lv 1 2 pts. 9,021
  8. Avatar for Steinkeule 198. Steinkeule Lv 1 2 pts. 9,014
  9. Avatar for JOMARCK 199. JOMARCK Lv 1 2 pts. 9,008
  10. Avatar for KesolIT 200. KesolIT Lv 1 2 pts. 9,005

Comments