Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for Barteczko 301. Barteczko Lv 1 1 pt. 5,594
  2. Avatar for JuFold 302. JuFold Lv 1 1 pt. 5,492
  3. Avatar for Panagiotis Drougkas 303. Panagiotis Drougkas Lv 1 1 pt. 5,431
  4. Avatar for Fourmize 304. Fourmize Lv 1 1 pt. 5,363
  5. Avatar for m_carmela 305. m_carmela Lv 1 1 pt. 4,165
  6. Avatar for lilroro 306. lilroro Lv 1 1 pt. 4,020
  7. Avatar for D4volution 307. D4volution Lv 1 1 pt. 3,594
  8. Avatar for sunmat 308. sunmat Lv 1 1 pt. 2,905
  9. Avatar for cirdec 309. cirdec Lv 1 1 pt. 2,862
  10. Avatar for diego.chen 310. diego.chen Lv 1 1 pt. 2,862

Comments