Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 10,270
  2. Avatar for CHNO Junkies 12. CHNO Junkies 1 pt. 9,871
  3. Avatar for xkcd 13. xkcd 1 pt. 9,831
  4. Avatar for Brony@Home 14. Brony@Home 1 pt. 9,802
  5. Avatar for Minions of TWIS 15. Minions of TWIS 1 pt. 9,782
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,458
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 9,213
  8. Avatar for ITAS Bocchialini - Parma 18. ITAS Bocchialini - Parma 1 pt. 8,966
  1. Avatar for Deleted player 61. Deleted player pts. 10,151
  2. Avatar for fpc 62. fpc Lv 1 37 pts. 10,133
  3. Avatar for Tygh 63. Tygh Lv 1 36 pts. 10,132
  4. Avatar for edpalas 64. edpalas Lv 1 36 pts. 10,122
  5. Avatar for stomjoh 65. stomjoh Lv 1 35 pts. 10,101
  6. Avatar for kathy65 66. kathy65 Lv 1 34 pts. 10,097
  7. Avatar for Cirraman 67. Cirraman Lv 1 34 pts. 10,096
  8. Avatar for alcor29 68. alcor29 Lv 1 33 pts. 10,067
  9. Avatar for neon_fuzz 69. neon_fuzz Lv 1 33 pts. 10,061
  10. Avatar for DoctorSockrates 70. DoctorSockrates Lv 1 32 pts. 10,046

Comments