Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Beta Folders 100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360

  1. Avatar for Zerg539 171. Zerg539 Lv 1 3 pts. 9,158
  2. Avatar for cjp 172. cjp Lv 1 3 pts. 9,156
  3. Avatar for justjustin 173. justjustin Lv 1 3 pts. 9,155
  4. Avatar for houbi 174. houbi Lv 1 3 pts. 9,155
  5. Avatar for chimpaznee 175. chimpaznee Lv 1 3 pts. 9,153
  6. Avatar for YellowBearPL 176. YellowBearPL Lv 1 3 pts. 9,140
  7. Avatar for Arthemian 177. Arthemian Lv 1 3 pts. 9,139
  8. Avatar for kzkm 178. kzkm Lv 1 3 pts. 9,134
  9. Avatar for Kahelthalas 179. Kahelthalas Lv 1 3 pts. 9,129
  10. Avatar for dudeman1st 180. dudeman1st Lv 1 3 pts. 9,128

Comments