Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Beta Folders 100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360

  1. Avatar for NicoloPetrolini 211. NicoloPetrolini Lv 1 1 pt. 8,966
  2. Avatar for Solver667 212. Solver667 Lv 1 1 pt. 8,965
  3. Avatar for WSQSylock 213. WSQSylock Lv 1 1 pt. 8,964
  4. Avatar for phamaximus 214. phamaximus Lv 1 1 pt. 8,963
  5. Avatar for ShadowTactics 215. ShadowTactics Lv 1 1 pt. 8,959
  6. Avatar for spartak 216. spartak Lv 1 1 pt. 8,957
  7. Avatar for IzNoGud78 217. IzNoGud78 Lv 1 1 pt. 8,956
  8. Avatar for wfujishima 218. wfujishima Lv 1 1 pt. 8,951
  9. Avatar for xunan 219. xunan Lv 1 1 pt. 8,945
  10. Avatar for skjhefijhe 220. skjhefijhe Lv 1 1 pt. 8,941

Comments