Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Beta Folders 100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360

  1. Avatar for Barteczko 301. Barteczko Lv 1 1 pt. 5,594
  2. Avatar for JuFold 302. JuFold Lv 1 1 pt. 5,492
  3. Avatar for Fourmize 304. Fourmize Lv 1 1 pt. 5,363
  4. Avatar for m_carmela 305. m_carmela Lv 1 1 pt. 4,165
  5. Avatar for lilroro 306. lilroro Lv 1 1 pt. 4,020
  6. Avatar for D4volution 307. D4volution Lv 1 1 pt. 3,594
  7. Avatar for sunmat 308. sunmat Lv 1 1 pt. 2,905
  8. Avatar for cirdec 309. cirdec Lv 1 1 pt. 2,862
  9. Avatar for YuuhiYuu 310. YuuhiYuu Lv 1 1 pt. 2,862

Comments