Placeholder image of a protein
Icon representing a puzzle

1807: Revisiting Puzzle 95: Chicken

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 03, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Beta Folders 100 pts. 10,830
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 10,825
  3. Avatar for Go Science 3. Go Science 54 pts. 10,820
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,612
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 10,550
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 10,522
  7. Avatar for Contenders 7. Contenders 12 pts. 10,501
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,434
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 10,406
  10. Avatar for Hold My Beer 10. Hold My Beer 3 pts. 10,360

  1. Avatar for kurenan 221. kurenan Lv 1 1 pt. 8,941
  2. Avatar for amvoled 222. amvoled Lv 1 1 pt. 8,939
  3. Avatar for YeloMello 223. YeloMello Lv 1 1 pt. 8,938
  4. Avatar for LordOfAgony 224. LordOfAgony Lv 1 1 pt. 8,934
  5. Avatar for doktar 225. doktar Lv 1 1 pt. 8,918
  6. Avatar for cjddig 226. cjddig Lv 1 1 pt. 8,911
  7. Avatar for lilei 227. lilei Lv 1 1 pt. 8,911
  8. Avatar for Kevin83 228. Kevin83 Lv 1 1 pt. 8,907
  9. Avatar for KDubCure 229. KDubCure Lv 1 1 pt. 8,895
  10. Avatar for ramando132 230. ramando132 Lv 1 1 pt. 8,894

Comments