1810: Revisiting Puzzle 96: Collagen
Closed since about 6 years ago
Novice Overall PredictionSummary
- Created
- March 09, 2020
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA
Top groups
-
1. Serca Lv 1100 pts. 10,222
-
-
-
-
-
-
-
-
-
Comments
jeff101 Lv 1
https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.
Deleted user
You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.