Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 9,081
  2. Avatar for The Daydreamers 12. The Daydreamers 4 pts. 9,065
  3. Avatar for Minions of TWIS 13. Minions of TWIS 3 pts. 8,928
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 8,901
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,882
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 8,877
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,873
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 8,671
  9. Avatar for BIOL 4030 Winter 2020 20. BIOL 4030 Winter 2020 1 pt. 8,486

  1. Avatar for nicobul 41. nicobul Lv 1 57 pts. 9,664
  2. Avatar for Vinara 42. Vinara Lv 1 56 pts. 9,640
  3. Avatar for diamonddays 43. diamonddays Lv 1 55 pts. 9,639
  4. Avatar for TastyMunchies 44. TastyMunchies Lv 1 55 pts. 9,605
  5. Avatar for Deleted player 45. Deleted player pts. 9,601
  6. Avatar for heather-1 46. heather-1 Lv 1 53 pts. 9,578
  7. Avatar for haabermaaster 47. haabermaaster Lv 1 52 pts. 9,572
  8. Avatar for Crossed Sticks 48. Crossed Sticks Lv 1 51 pts. 9,564
  9. Avatar for WBarme1234 49. WBarme1234 Lv 1 51 pts. 9,484
  10. Avatar for DoctorSockrates 50. DoctorSockrates Lv 1 50 pts. 9,466

Comments


jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.