Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Void Crushers 11. Void Crushers 6 pts. 9,081
  2. Avatar for The Daydreamers 12. The Daydreamers 4 pts. 9,065
  3. Avatar for Minions of TWIS 13. Minions of TWIS 3 pts. 8,928
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 2 pts. 8,901
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 8,882
  6. Avatar for CHNO Junkies 16. CHNO Junkies 1 pt. 8,877
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,873
  8. Avatar for Mojo Risin' 18. Mojo Risin' 1 pt. 8,671
  9. Avatar for BIOL 4030 Winter 2020 20. BIOL 4030 Winter 2020 1 pt. 8,486

  1. Avatar for Cobralilie 81. Cobralilie Lv 1 30 pts. 8,998
  2. Avatar for Cirraman 82. Cirraman Lv 1 30 pts. 8,986
  3. Avatar for Merf 83. Merf Lv 1 29 pts. 8,978
  4. Avatar for rabamino12358 84. rabamino12358 Lv 1 29 pts. 8,973
  5. Avatar for fearjuan 85. fearjuan Lv 1 28 pts. 8,958
  6. Avatar for xythus 86. xythus Lv 1 28 pts. 8,946
  7. Avatar for wanderlust1 87. wanderlust1 Lv 1 27 pts. 8,936
  8. Avatar for chadster987 88. chadster987 Lv 1 27 pts. 8,936
  9. Avatar for infjamc 89. infjamc Lv 1 26 pts. 8,929
  10. Avatar for gldisater 90. gldisater Lv 1 26 pts. 8,928

Comments


jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.