Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Team China 21. Team China 1 pt. 8,425
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,302
  3. Avatar for GHS Biology 23. GHS Biology 1 pt. 6,782
  4. Avatar for Covid19Busters 24. Covid19Busters 1 pt. 3,129

  1. Avatar for _MATH KING 261. _MATH KING Lv 1 1 pt. 8,142
  2. Avatar for obbo 262. obbo Lv 1 1 pt. 8,138
  3. Avatar for DesanimadoX 263. DesanimadoX Lv 1 1 pt. 8,134
  4. Avatar for Machelan 264. Machelan Lv 1 1 pt. 8,133
  5. Avatar for cohomology 265. cohomology Lv 1 1 pt. 8,130
  6. Avatar for Quamtiam 266. Quamtiam Lv 1 1 pt. 8,126
  7. Avatar for noki007 267. noki007 Lv 1 1 pt. 8,125
  8. Avatar for natale83 268. natale83 Lv 1 1 pt. 8,122
  9. Avatar for laucaspe 269. laucaspe Lv 1 1 pt. 8,119
  10. Avatar for Thrann 270. Thrann Lv 1 1 pt. 8,119

Comments


jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.