Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 8,425
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,302
  3. Avatar for GHS Biology 23. GHS Biology 1 pt. 6,782
  4. Avatar for Covid19Busters 24. Covid19Busters 1 pt. 3,129
  1. Avatar for jausmh 61. jausmh Lv 1 42 pts. 9,277
  2. Avatar for Steven Pletsch 62. Steven Pletsch Lv 1 41 pts. 9,262
  3. Avatar for knotartist 63. knotartist Lv 1 41 pts. 9,208
  4. Avatar for hansvandenhof 64. hansvandenhof Lv 1 40 pts. 9,205
  5. Avatar for georg137 65. georg137 Lv 1 39 pts. 9,197
  6. Avatar for Heinermann 66. Heinermann Lv 1 39 pts. 9,177
  7. Avatar for Tygh 67. Tygh Lv 1 38 pts. 9,157
  8. Avatar for Pawel Tluscik 68. Pawel Tluscik Lv 1 37 pts. 9,142
  9. Avatar for abiogenesis 69. abiogenesis Lv 1 37 pts. 9,141
  10. Avatar for PeterDav 70. PeterDav Lv 1 36 pts. 9,109

Comments

jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.