Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 8,425
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,302
  3. Avatar for GHS Biology 23. GHS Biology 1 pt. 6,782
  4. Avatar for Covid19Busters 24. Covid19Busters 1 pt. 3,129
  1. Avatar for Amphimixus 71. Amphimixus Lv 1 36 pts. 9,092
  2. Avatar for JasperD 72. JasperD Lv 1 35 pts. 9,082
  3. Avatar for firejuggler 73. firejuggler Lv 1 35 pts. 9,081
  4. Avatar for Cloudy101 74. Cloudy101 Lv 1 34 pts. 9,065
  5. Avatar for SKSbell 75. SKSbell Lv 1 33 pts. 9,054
  6. Avatar for fehEryeah 76. fehEryeah Lv 1 33 pts. 9,020
  7. Avatar for James Durden 77. James Durden Lv 1 32 pts. 9,018
  8. Avatar for John McLeod 78. John McLeod Lv 1 32 pts. 9,013
  9. Avatar for Alistair69 79. Alistair69 Lv 1 31 pts. 9,011
  10. Avatar for soulorcell 80. soulorcell Lv 1 31 pts. 9,001

Comments

jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.