Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Go Science 100 pts. 10,222
  2. Avatar for Marvin's bunch 2. Marvin's bunch 81 pts. 10,186
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 10,185
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 10,126
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 39 pts. 10,094
  6. Avatar for Contenders 6. Contenders 30 pts. 9,981
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,875
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 17 pts. 9,721
  9. Avatar for HMT heritage 9. HMT heritage 12 pts. 9,461
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 9,262

  1. Avatar for SWR_DMaster 101. SWR_DMaster Lv 1 21 pts. 8,861
  2. Avatar for Babczyk 102. Babczyk Lv 1 21 pts. 8,860
  3. Avatar for Roukess67 103. Roukess67 Lv 1 21 pts. 8,858
  4. Avatar for edpalas 104. edpalas Lv 1 20 pts. 8,856
  5. Avatar for Origami314 105. Origami314 Lv 1 20 pts. 8,844
  6. Avatar for Simek 106. Simek Lv 1 19 pts. 8,828
  7. Avatar for Cluckinator 107. Cluckinator Lv 1 19 pts. 8,818
  8. Avatar for TimothyJHLong 108. TimothyJHLong Lv 1 19 pts. 8,817
  9. Avatar for frostschutz 109. frostschutz Lv 1 18 pts. 8,815
  10. Avatar for CAN1958 110. CAN1958 Lv 1 18 pts. 8,807

Comments


jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.