Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Go Science 100 pts. 10,222
  2. Avatar for Marvin's bunch 2. Marvin's bunch 81 pts. 10,186
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 10,185
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 10,126
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 39 pts. 10,094
  6. Avatar for Contenders 6. Contenders 30 pts. 9,981
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,875
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 17 pts. 9,721
  9. Avatar for HMT heritage 9. HMT heritage 12 pts. 9,461
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 9,262

  1. Avatar for jamiexq 151. jamiexq Lv 1 8 pts. 8,521
  2. Avatar for Strawberry7 152. Strawberry7 Lv 1 8 pts. 8,513
  3. Avatar for P_hoenix88 153. P_hoenix88 Lv 1 8 pts. 8,513
  4. Avatar for pente_player 154. pente_player Lv 1 8 pts. 8,497
  5. Avatar for Claudio.Gennari 155. Claudio.Gennari Lv 1 7 pts. 8,491
  6. Avatar for Deleted player 156. Deleted player pts. 8,486
  7. Avatar for 4030_20_Thai 157. 4030_20_Thai Lv 1 7 pts. 8,486
  8. Avatar for rlee287 158. rlee287 Lv 1 7 pts. 8,484
  9. Avatar for nailtailbee 159. nailtailbee Lv 1 7 pts. 8,479
  10. Avatar for backterria 160. backterria Lv 1 7 pts. 8,477

Comments


jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.