Placeholder image of a protein
Icon representing a puzzle

1810: Revisiting Puzzle 96: Collagen

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 09, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,222
  2. Avatar for Marvin's bunch 2. Marvin's bunch 81 pts. 10,186
  3. Avatar for Beta Folders 3. Beta Folders 64 pts. 10,185
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 50 pts. 10,126
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 39 pts. 10,094
  6. Avatar for Contenders 6. Contenders 30 pts. 9,981
  7. Avatar for Gargleblasters 7. Gargleblasters 23 pts. 9,875
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 17 pts. 9,721
  9. Avatar for HMT heritage 9. HMT heritage 12 pts. 9,461
  10. Avatar for Hold My Beer 10. Hold My Beer 9 pts. 9,262
  1. Avatar for cecielSCC 291. cecielSCC Lv 1 1 pt. 7,972
  2. Avatar for nif_aka_shaun 292. nif_aka_shaun Lv 1 1 pt. 7,967
  3. Avatar for corona2020 293. corona2020 Lv 1 1 pt. 7,961
  4. Avatar for Pearlw1 294. Pearlw1 Lv 1 1 pt. 7,949
  5. Avatar for yonathan1626 295. yonathan1626 Lv 1 1 pt. 7,936
  6. Avatar for MistrDavid 296. MistrDavid Lv 1 1 pt. 7,914
  7. Avatar for Rezendo 297. Rezendo Lv 1 1 pt. 7,898
  8. Avatar for sander2774 298. sander2774 Lv 1 1 pt. 7,894
  9. Avatar for zolq85 299. zolq85 Lv 1 1 pt. 7,872
  10. Avatar for Sascha73 300. Sascha73 Lv 1 1 pt. 7,865

Comments

jeff101 Lv 1

https://fold.it/portal/node/2008302
about poly-proline helix puzzles got
me curious about this puzzle. Isn't
collagen supposed to have 3 strands of
ppg repeats with the poly-proline helix
structure? Meanwhile, this puzzle has
one strand of 55 amino acids, just 2
prolines, and only 6 glycines. Is this
puzzle really collagen? Please explain.

Deleted user

You're right! This puzzle is not actually collagen, but a protein that helps make it in the human body. It is extremely important, and a lack of it has been connected to a number of muscular and connective tissue disorders. The form of collagen for the poly-proline helix puzzles is real human collagen, based on the PDB 1bkv, which does (for the most part) maintain the PPG motif.