Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for rinze 91. rinze Lv 1 26 pts. 9,801
  2. Avatar for rabamino12358 92. rabamino12358 Lv 1 26 pts. 9,792
  3. Avatar for abiogenesis 93. abiogenesis Lv 1 25 pts. 9,792
  4. Avatar for apn 94. apn Lv 1 25 pts. 9,783
  5. Avatar for Deleted player 95. Deleted player 25 pts. 9,781
  6. Avatar for knotartist 96. knotartist Lv 1 24 pts. 9,764
  7. Avatar for tlaran 97. tlaran Lv 1 24 pts. 9,763
  8. Avatar for Flaku 98. Flaku Lv 1 23 pts. 9,709
  9. Avatar for haabermaaster 99. haabermaaster Lv 1 23 pts. 9,670
  10. Avatar for kubek915 100. kubek915 Lv 1 23 pts. 9,664

Comments