Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663

  1. Avatar for utac76 141. utac76 Lv 1 10 pts. 9,296
  2. Avatar for marsfan 142. marsfan Lv 1 10 pts. 9,294
  3. Avatar for SkullPrism 143. SkullPrism Lv 1 10 pts. 9,287
  4. Avatar for samchop 144. samchop Lv 1 10 pts. 9,286
  5. Avatar for muffnerk 145. muffnerk Lv 1 10 pts. 9,286
  6. Avatar for gomibako 146. gomibako Lv 1 9 pts. 9,274
  7. Avatar for lirpa 147. lirpa Lv 1 9 pts. 9,271
  8. Avatar for rol 148. rol Lv 1 9 pts. 9,258
  9. Avatar for NeLikomSheet 149. NeLikomSheet Lv 1 9 pts. 9,239
  10. Avatar for Strawberry7 150. Strawberry7 Lv 1 9 pts. 9,238

Comments