Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for wangkl 201. wangkl Lv 1 3 pts. 8,791
  2. Avatar for BlissVelvet 202. BlissVelvet Lv 1 3 pts. 8,789
  3. Avatar for Proteina00 203. Proteina00 Lv 1 3 pts. 8,781
  4. Avatar for ogiv 204. ogiv Lv 1 3 pts. 8,776
  5. Avatar for falck 205. falck Lv 1 3 pts. 8,775
  6. Avatar for jit 206. jit Lv 1 3 pts. 8,775
  7. Avatar for katling 207. katling Lv 1 2 pts. 8,770
  8. Avatar for pruneau_44 208. pruneau_44 Lv 1 2 pts. 8,770
  9. Avatar for Maser312 209. Maser312 Lv 1 2 pts. 8,768
  10. Avatar for RobotMiner 210. RobotMiner Lv 1 2 pts. 8,768

Comments