Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for normandl 221. normandl Lv 1 2 pts. 8,727
  2. Avatar for -Cel- 222. -Cel- Lv 1 2 pts. 8,726
  3. Avatar for Madmax360 223. Madmax360 Lv 1 2 pts. 8,721
  4. Avatar for gbdj 224. gbdj Lv 1 2 pts. 8,718
  5. Avatar for roblober 225. roblober Lv 1 2 pts. 8,716
  6. Avatar for sztumka 226. sztumka Lv 1 2 pts. 8,715
  7. Avatar for ScyllaHide 227. ScyllaHide Lv 1 2 pts. 8,711
  8. Avatar for asiway 228. asiway Lv 1 2 pts. 8,710
  9. Avatar for Rodrigo Weriky 229. Rodrigo Weriky Lv 1 2 pts. 8,709
  10. Avatar for eple 230. eple Lv 1 1 pt. 8,704

Comments