Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for swl369 241. swl369 Lv 1 1 pt. 8,687
  2. Avatar for Joel260 242. Joel260 Lv 1 1 pt. 8,686
  3. Avatar for jonesman164 243. jonesman164 Lv 1 1 pt. 8,684
  4. Avatar for frostschutz 244. frostschutz Lv 1 1 pt. 8,681
  5. Avatar for malavi 245. malavi Lv 1 1 pt. 8,680
  6. Avatar for JTKnorr 246. JTKnorr Lv 1 1 pt. 8,679
  7. Avatar for Bienchen_123 247. Bienchen_123 Lv 1 1 pt. 8,677
  8. Avatar for CrossSashley da youtuber 248. CrossSashley da youtuber Lv 1 1 pt. 8,670
  9. Avatar for 23watejona 249. 23watejona Lv 1 1 pt. 8,670
  10. Avatar for DH5alpha 250. DH5alpha Lv 1 1 pt. 8,665

Comments