Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 10 pts. 10,137
  2. Avatar for Russian team 12. Russian team 8 pts. 10,096
  3. Avatar for Contenders 13. Contenders 6 pts. 10,075
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 4 pts. 10,064
  5. Avatar for Trinity Biology 15. Trinity Biology 3 pts. 10,005
  6. Avatar for Hold My Beer 16. Hold My Beer 2 pts. 9,975
  7. Avatar for CHNO Junkies 17. CHNO Junkies 2 pts. 9,936
  8. Avatar for BOINC@Poland 18. BOINC@Poland 1 pt. 9,709
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 9,670
  10. Avatar for Team India 20. Team India 1 pt. 9,663
  1. Avatar for Bieso 301. Bieso Lv 1 1 pt. 8,374
  2. Avatar for Najamuddin 302. Najamuddin Lv 1 1 pt. 8,332
  3. Avatar for blublugwen 303. blublugwen Lv 1 1 pt. 8,319
  4. Avatar for QBA 304. QBA Lv 1 1 pt. 8,275
  5. Avatar for Litokaunen 305. Litokaunen Lv 1 1 pt. 8,261
  6. Avatar for mephistophele 306. mephistophele Lv 1 1 pt. 8,246
  7. Avatar for enzik 307. enzik Lv 1 1 pt. 8,228
  8. Avatar for URGEN5 308. URGEN5 Lv 1 1 pt. 8,176
  9. Avatar for cebt103320058 309. cebt103320058 Lv 1 1 pt. 8,172
  10. Avatar for kerobird 310. kerobird Lv 1 1 pt. 8,145

Comments