Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 1 pt. 9,406
  2. Avatar for Team China 22. Team China 1 pt. 8,906
  3. Avatar for Deleted group 23. Deleted group pts. 8,781
  4. Avatar for Coastal Biochemistry 24. Coastal Biochemistry 1 pt. 8,694
  5. Avatar for Penny-Arcade 25. Penny-Arcade 1 pt. 8,691
  6. Avatar for ITESO2017O 26. ITESO2017O 1 pt. 8,087
  7. Avatar for BIOL 4030 Winter 2020 27. BIOL 4030 Winter 2020 1 pt. 6,190
  8. Avatar for foldeRNA 28. foldeRNA 1 pt. 5,467
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 11,074
  2. Avatar for Serca 2. Serca Lv 1 99 pts. 11,043
  3. Avatar for LociOiling 3. LociOiling Lv 1 98 pts. 11,027
  4. Avatar for frood66 4. frood66 Lv 1 97 pts. 10,953
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 95 pts. 10,923
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 94 pts. 10,914
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 93 pts. 10,897
  8. Avatar for Keresto 8. Keresto Lv 1 92 pts. 10,895
  9. Avatar for Galaxie 9. Galaxie Lv 1 90 pts. 10,868
  10. Avatar for guineapig 10. guineapig Lv 1 89 pts. 10,817

Comments