Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288
  1. Avatar for robgee 11. robgee Lv 1 5 pts. 10,957
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 4 pts. 10,956
  3. Avatar for pente_player 13. pente_player Lv 1 2 pts. 10,894
  4. Avatar for Phyx 14. Phyx Lv 1 2 pts. 10,881
  5. Avatar for Jpilkington 15. Jpilkington Lv 1 1 pt. 10,862
  6. Avatar for knotartist 16. knotartist Lv 1 1 pt. 10,848
  7. Avatar for ManVsYard 17. ManVsYard Lv 1 1 pt. 10,831
  8. Avatar for alcor29 18. alcor29 Lv 1 1 pt. 10,422
  9. Avatar for phi16 19. phi16 Lv 1 1 pt. 10,421
  10. Avatar for donuts554 20. donuts554 Lv 1 1 pt. 10,262

Comments