Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288

  1. Avatar for xyzzyx13 271. xyzzyx13 Lv 1 1 pt. 8,579
  2. Avatar for PolderDeichkind 272. PolderDeichkind Lv 1 1 pt. 8,568
  3. Avatar for angazit 273. angazit Lv 1 1 pt. 8,563
  4. Avatar for Maniaq 274. Maniaq Lv 1 1 pt. 8,562
  5. Avatar for zerbi2020 275. zerbi2020 Lv 1 1 pt. 8,556
  6. Avatar for addict666 276. addict666 Lv 1 1 pt. 8,547
  7. Avatar for nebu84 277. nebu84 Lv 1 1 pt. 8,546
  8. Avatar for kevin everington 278. kevin everington Lv 1 1 pt. 8,543
  9. Avatar for Akida 279. Akida Lv 1 1 pt. 8,543
  10. Avatar for Jonah2020 280. Jonah2020 Lv 1 1 pt. 8,540

Comments