Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288

  1. Avatar for LE MEUR 342. LE MEUR Lv 1 1 pt. 6,365
  2. Avatar for Hannes93 343. Hannes93 Lv 1 1 pt. 6,349
  3. Avatar for doud1er 344. doud1er Lv 1 1 pt. 6,326
  4. Avatar for tetokay 345. tetokay Lv 1 1 pt. 6,300
  5. Avatar for DangerDog_ 346. DangerDog_ Lv 1 1 pt. 6,233
  6. Avatar for 4030_20_Ali 347. 4030_20_Ali Lv 1 1 pt. 6,190
  7. Avatar for Malaquias 348. Malaquias Lv 1 1 pt. 6,050
  8. Avatar for TesterXXX 349. TesterXXX Lv 1 1 pt. 6,040
  9. Avatar for yassi87 350. yassi87 Lv 1 1 pt. 5,974

Comments