Placeholder image of a protein
Icon representing a puzzle

1813: Revisiting Puzzle 97: Pig

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,074
  2. Avatar for Marvin's bunch 2. Marvin's bunch 83 pts. 11,052
  3. Avatar for Go Science 3. Go Science 69 pts. 11,043
  4. Avatar for Beta Folders 4. Beta Folders 56 pts. 11,030
  5. Avatar for Gargleblasters 5. Gargleblasters 45 pts. 10,895
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 36 pts. 10,761
  7. Avatar for HMT heritage 7. HMT heritage 29 pts. 10,544
  8. Avatar for Herobrine's Army 8. Herobrine's Army 23 pts. 10,469
  9. Avatar for Void Crushers 9. Void Crushers 18 pts. 10,292
  10. Avatar for SETI.Germany 10. SETI.Germany 14 pts. 10,288

  1. Avatar for pmlkjn 81. pmlkjn Lv 1 31 pts. 9,936
  2. Avatar for Barium56 82. Barium56 Lv 1 31 pts. 9,934
  3. Avatar for donuts554 83. donuts554 Lv 1 30 pts. 9,934
  4. Avatar for kathy65 84. kathy65 Lv 1 30 pts. 9,924
  5. Avatar for harvardman 85. harvardman Lv 1 29 pts. 9,916
  6. Avatar for TheGUmmer 86. TheGUmmer Lv 1 29 pts. 9,906
  7. Avatar for fearjuan 87. fearjuan Lv 1 28 pts. 9,904
  8. Avatar for Tygh 88. Tygh Lv 1 28 pts. 9,890
  9. Avatar for hansvandenhof 89. hansvandenhof Lv 1 27 pts. 9,865
  10. Avatar for cryptoriddler 90. cryptoriddler Lv 1 27 pts. 9,825

Comments