Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Russian team 19. Russian team 1 pt. 8,535
  9. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,246
  2. Avatar for robgee 2. robgee Lv 1 81 pts. 9,194
  3. Avatar for alwen 3. alwen Lv 1 64 pts. 9,188
  4. Avatar for phi16 4. phi16 Lv 1 50 pts. 9,186
  5. Avatar for alcor29 5. alcor29 Lv 1 39 pts. 9,153
  6. Avatar for Deleted player 6. Deleted player 30 pts. 9,151
  7. Avatar for LociOiling 7. LociOiling Lv 1 23 pts. 9,151
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 17 pts. 9,132
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 12 pts. 9,131
  10. Avatar for mirp 10. mirp Lv 1 9 pts. 9,127

Comments