Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Russian team 19. Russian team 1 pt. 8,535
  9. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465

  1. Avatar for guineapig 151. guineapig Lv 1 14 pts. 8,453
  2. Avatar for Simek 152. Simek Lv 1 14 pts. 8,449
  3. Avatar for pascal ochem 153. pascal ochem Lv 1 14 pts. 8,442
  4. Avatar for iRob 154. iRob Lv 1 13 pts. 8,437
  5. Avatar for koldo87 155. koldo87 Lv 1 13 pts. 8,433
  6. Avatar for edpalas 156. edpalas Lv 1 13 pts. 8,426
  7. Avatar for pente_player 157. pente_player Lv 1 13 pts. 8,425
  8. Avatar for Bogden 158. Bogden Lv 1 13 pts. 8,425
  9. Avatar for papasmurf01 159. papasmurf01 Lv 1 12 pts. 8,423
  10. Avatar for badgoes 160. badgoes Lv 1 12 pts. 8,418

Comments