Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Russian team 19. Russian team 1 pt. 8,535
  9. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465

  1. Avatar for tobtel 201. tobtel Lv 1 6 pts. 8,271
  2. Avatar for foldit109ljsd 202. foldit109ljsd Lv 1 6 pts. 8,266
  3. Avatar for Viktor_Kostin 203. Viktor_Kostin Lv 1 6 pts. 8,262
  4. Avatar for mibarb 204. mibarb Lv 1 6 pts. 8,257
  5. Avatar for malith 205. malith Lv 1 6 pts. 8,256
  6. Avatar for OrgCheMK 206. OrgCheMK Lv 1 6 pts. 8,249
  7. Avatar for Altercomp 207. Altercomp Lv 1 5 pts. 8,247
  8. Avatar for apollon 208. apollon Lv 1 5 pts. 8,242
  9. Avatar for ttti07 209. ttti07 Lv 1 5 pts. 8,242
  10. Avatar for lulu0910 210. lulu0910 Lv 1 5 pts. 8,240

Comments