Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,608
  9. Avatar for Russian team 19. Russian team 1 pt. 8,535
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465
  1. Avatar for rsoliwoda 261. rsoliwoda Lv 1 2 pts. 8,134
  2. Avatar for ScyllaHide 262. ScyllaHide Lv 1 2 pts. 8,132
  3. Avatar for YellowBearPL 263. YellowBearPL Lv 1 2 pts. 8,128
  4. Avatar for ForrestBC 264. ForrestBC Lv 1 2 pts. 8,128
  5. Avatar for HMK 265. HMK Lv 1 2 pts. 8,126
  6. Avatar for Martin003 266. Martin003 Lv 1 2 pts. 8,124
  7. Avatar for seica 267. seica Lv 1 2 pts. 8,123
  8. Avatar for Tidoni 268. Tidoni Lv 1 2 pts. 8,123
  9. Avatar for airix 269. airix Lv 1 2 pts. 8,120
  10. Avatar for TREVOR.w.grose 270. TREVOR.w.grose Lv 1 2 pts. 8,120

Comments