Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Russian team 19. Russian team 1 pt. 8,535
  9. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465

  1. Avatar for GrisuDerDrache 331. GrisuDerDrache Lv 1 1 pt. 7,999
  2. Avatar for pawee pro 332. pawee pro Lv 1 1 pt. 7,997
  3. Avatar for 420impatient 333. 420impatient Lv 1 1 pt. 7,987
  4. Avatar for Prof.Dr.Tee 334. Prof.Dr.Tee Lv 1 1 pt. 7,986
  5. Avatar for Egaaal 335. Egaaal Lv 1 1 pt. 7,982
  6. Avatar for jft 336. jft Lv 1 1 pt. 7,979
  7. Avatar for Bri-Ta 337. Bri-Ta Lv 1 1 pt. 7,977
  8. Avatar for Mustermann1234 338. Mustermann1234 Lv 1 1 pt. 7,970
  9. Avatar for dankofscotland 339. dankofscotland Lv 1 1 pt. 7,968
  10. Avatar for thorgard 340. thorgard Lv 1 1 pt. 7,967

Comments