Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Russian team 19. Russian team 1 pt. 8,535
  9. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465

  1. Avatar for Emma2012 351. Emma2012 Lv 1 1 pt. 7,913
  2. Avatar for oilman 352. oilman Lv 1 1 pt. 7,896
  3. Avatar for mandarine22 353. mandarine22 Lv 1 1 pt. 7,896
  4. Avatar for Ayaka-Kami 354. Ayaka-Kami Lv 1 1 pt. 7,894
  5. Avatar for Familie Sackewitz 355. Familie Sackewitz Lv 1 1 pt. 7,886
  6. Avatar for Alexei2511 356. Alexei2511 Lv 1 1 pt. 7,874
  7. Avatar for JustinRothganger 357. JustinRothganger Lv 1 1 pt. 7,873
  8. Avatar for walepa 358. walepa Lv 1 1 pt. 7,817
  9. Avatar for qusilen 359. qusilen Lv 1 1 pt. 7,789
  10. Avatar for DooMSlayer92 360. DooMSlayer92 Lv 1 1 pt. 7,751

Comments