Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,608
  9. Avatar for Russian team 19. Russian team 1 pt. 8,535
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465
  1. Avatar for kavakava2357 361. kavakava2357 Lv 1 1 pt. 7,742
  2. Avatar for efe16 362. efe16 Lv 1 1 pt. 7,737
  3. Avatar for OpaSchwitzt 363. OpaSchwitzt Lv 1 1 pt. 7,730
  4. Avatar for stablechocolate 364. stablechocolate Lv 1 1 pt. 7,726
  5. Avatar for YashviP20 365. YashviP20 Lv 1 1 pt. 7,712
  6. Avatar for Nitz97 366. Nitz97 Lv 1 1 pt. 7,711
  7. Avatar for Cryptogirl 367. Cryptogirl Lv 1 1 pt. 7,709
  8. Avatar for Morningtalk 368. Morningtalk Lv 1 1 pt. 7,709
  9. Avatar for dorilolo 369. dorilolo Lv 1 1 pt. 7,709
  10. Avatar for angazit 370. angazit Lv 1 1 pt. 7,709

Comments