Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,608
  9. Avatar for Russian team 19. Russian team 1 pt. 8,535
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465
  1. Avatar for xotwod 381. xotwod Lv 1 1 pt. 7,635
  2. Avatar for Goldfisch222 382. Goldfisch222 Lv 1 1 pt. 7,631
  3. Avatar for TesterXXX 383. TesterXXX Lv 1 1 pt. 7,630
  4. Avatar for irida opeth 384. irida opeth Lv 1 1 pt. 7,610
  5. Avatar for Missi Patscher 385. Missi Patscher Lv 1 1 pt. 7,610
  6. Avatar for Cristhian 386. Cristhian Lv 1 1 pt. 7,609
  7. Avatar for AbiM603 387. AbiM603 Lv 1 1 pt. 7,594
  8. Avatar for simonschoeff 388. simonschoeff Lv 1 1 pt. 7,586
  9. Avatar for erik6800 389. erik6800 Lv 1 1 pt. 7,585
  10. Avatar for arshia123 390. arshia123 Lv 1 1 pt. 7,575

Comments