Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Russian team 19. Russian team 1 pt. 8,535
  9. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465

  1. Avatar for ThOrtmeier 412. ThOrtmeier Lv 1 1 pt. 6,238
  2. Avatar for oxien97 413. oxien97 Lv 1 1 pt. 6,236
  3. Avatar for Paprika55 414. Paprika55 Lv 1 1 pt. 6,223
  4. Avatar for OliverSiegmund 415. OliverSiegmund Lv 1 1 pt. 6,219
  5. Avatar for Tom der Beste 416. Tom der Beste Lv 1 1 pt. 6,213
  6. Avatar for chubidubiman 417. chubidubiman Lv 1 1 pt. 6,209
  7. Avatar for vaskania 418. vaskania Lv 1 1 pt. 6,179
  8. Avatar for Sprint 419. Sprint Lv 1 1 pt. 6,166
  9. Avatar for Hphone123 420. Hphone123 Lv 1 1 pt. 6,131

Comments