Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,608
  9. Avatar for Russian team 19. Russian team 1 pt. 8,535
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465
  1. Avatar for Pepe90 421. Pepe90 Lv 1 1 pt. 6,121
  2. Avatar for baobao123 422. baobao123 Lv 1 1 pt. 6,095
  3. Avatar for Mike81 423. Mike81 Lv 1 1 pt. 6,076
  4. Avatar for FreddyTB 424. FreddyTB Lv 1 1 pt. 6,075
  5. Avatar for Vavelidis 425. Vavelidis Lv 1 1 pt. 6,068
  6. Avatar for Robotnick 426. Robotnick Lv 1 1 pt. 6,030
  7. Avatar for qwertzuiopasdfghjkl 427. qwertzuiopasdfghjkl Lv 1 1 pt. 6,028
  8. Avatar for charles2903 428. charles2903 Lv 1 1 pt. 5,945
  9. Avatar for Rosie01 429. Rosie01 Lv 1 1 pt. 5,872
  10. Avatar for jeffone 430. jeffone Lv 1 1 pt. 5,838

Comments