Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,608
  9. Avatar for Russian team 19. Russian team 1 pt. 8,535
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465
  1. Avatar for haabermaaster 41. haabermaaster Lv 1 64 pts. 8,960
  2. Avatar for DoctorSockrates 42. DoctorSockrates Lv 1 63 pts. 8,951
  3. Avatar for Deleted player 43. Deleted player 62 pts. 8,949
  4. Avatar for jausmh 44. jausmh Lv 1 61 pts. 8,940
  5. Avatar for pauldunn 45. pauldunn Lv 1 61 pts. 8,935
  6. Avatar for OWM3 46. OWM3 Lv 1 60 pts. 8,933
  7. Avatar for SWR_DMaster 47. SWR_DMaster Lv 1 59 pts. 8,931
  8. Avatar for Crossed Sticks 48. Crossed Sticks Lv 1 58 pts. 8,931
  9. Avatar for tangofox10 49. tangofox10 Lv 1 58 pts. 8,923
  10. Avatar for Renthel 50. Renthel Lv 1 57 pts. 8,922

Comments