Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 6 pts. 8,989
  2. Avatar for Marvin's bunch 12. Marvin's bunch 4 pts. 8,984
  3. Avatar for Herobrine's Army 13. Herobrine's Army 3 pts. 8,977
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,960
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,911
  6. Avatar for Penny-Arcade 16. Penny-Arcade 1 pt. 8,766
  7. Avatar for BOINC@Poland 17. BOINC@Poland 1 pt. 8,693
  8. Avatar for Richard Dawkins Foundation 18. Richard Dawkins Foundation 1 pt. 8,608
  9. Avatar for Russian team 19. Russian team 1 pt. 8,535
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 8,465
  1. Avatar for TheGUmmer 61. TheGUmmer Lv 1 50 pts. 8,852
  2. Avatar for jsfoldingaccount 62. jsfoldingaccount Lv 1 49 pts. 8,847
  3. Avatar for heather-1 63. heather-1 Lv 1 49 pts. 8,840
  4. Avatar for WBarme1234 64. WBarme1234 Lv 1 48 pts. 8,837
  5. Avatar for pangaena 65. pangaena Lv 1 47 pts. 8,835
  6. Avatar for firejuggler 66. firejuggler Lv 1 47 pts. 8,834
  7. Avatar for alcor29 67. alcor29 Lv 1 46 pts. 8,826
  8. Avatar for frood66 68. frood66 Lv 1 46 pts. 8,821
  9. Avatar for Pawel Tluscik 69. Pawel Tluscik Lv 1 45 pts. 8,820
  10. Avatar for abiogenesis 70. abiogenesis Lv 1 44 pts. 8,809

Comments