Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,246
  2. Avatar for robgee 2. robgee Lv 1 81 pts. 9,194
  3. Avatar for alwen 3. alwen Lv 1 64 pts. 9,188
  4. Avatar for phi16 4. phi16 Lv 1 50 pts. 9,186
  5. Avatar for alcor29 5. alcor29 Lv 1 39 pts. 9,153
  6. Avatar for Deleted player 6. Deleted player 30 pts. 9,151
  7. Avatar for LociOiling 7. LociOiling Lv 1 23 pts. 9,151
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 17 pts. 9,132
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 12 pts. 9,131
  10. Avatar for mirp 10. mirp Lv 1 9 pts. 9,127

Comments