Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,246
  2. Avatar for jobo0502 2. jobo0502 Lv 1 99 pts. 9,221
  3. Avatar for fiendish_ghoul 3. fiendish_ghoul Lv 1 98 pts. 9,179
  4. Avatar for LociOiling 4. LociOiling Lv 1 97 pts. 9,162
  5. Avatar for diamonddays 5. diamonddays Lv 1 96 pts. 9,148
  6. Avatar for johnmitch 6. johnmitch Lv 1 95 pts. 9,148
  7. Avatar for BrKapr 7. BrKapr Lv 1 94 pts. 9,139
  8. Avatar for mirp 8. mirp Lv 1 93 pts. 9,128
  9. Avatar for grogar7 9. grogar7 Lv 1 92 pts. 9,124
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 91 pts. 9,122

Comments