Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076

  1. Avatar for NicolasDorn 91. NicolasDorn Lv 1 34 pts. 8,705
  2. Avatar for wosser1 92. wosser1 Lv 1 33 pts. 8,705
  3. Avatar for Rav3n_pl 93. Rav3n_pl Lv 1 33 pts. 8,698
  4. Avatar for kitek314_pl 94. kitek314_pl Lv 1 32 pts. 8,693
  5. Avatar for Arne Heessels 95. Arne Heessels Lv 1 32 pts. 8,691
  6. Avatar for fisherlr777 96. fisherlr777 Lv 1 32 pts. 8,683
  7. Avatar for John McLeod 97. John McLeod Lv 1 31 pts. 8,680
  8. Avatar for rezaefar 98. rezaefar Lv 1 31 pts. 8,679
  9. Avatar for Oransche 99. Oransche Lv 1 30 pts. 8,667
  10. Avatar for Dolichwier 100. Dolichwier Lv 1 30 pts. 8,658

Comments