Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for enntau 101. enntau Lv 1 29 pts. 8,652
  2. Avatar for ironchefnorse 102. ironchefnorse Lv 1 29 pts. 8,643
  3. Avatar for pingas as usual 103. pingas as usual Lv 1 29 pts. 8,636
  4. Avatar for evifnoskcaj 104. evifnoskcaj Lv 1 28 pts. 8,633
  5. Avatar for Black Dahlia 105. Black Dahlia Lv 1 28 pts. 8,631
  6. Avatar for Staubfinger 106. Staubfinger Lv 1 27 pts. 8,629
  7. Avatar for MrZanav 107. MrZanav Lv 1 27 pts. 8,621
  8. Avatar for fearjuan 108. fearjuan Lv 1 27 pts. 8,616
  9. Avatar for knotartist 109. knotartist Lv 1 26 pts. 8,614
  10. Avatar for wudoo 110. wudoo Lv 1 26 pts. 8,611

Comments