Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Overall Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for nathanmills 111. nathanmills Lv 1 26 pts. 8,608
  2. Avatar for Jpilkington 112. Jpilkington Lv 1 25 pts. 8,604
  3. Avatar for Hum 113. Hum Lv 1 25 pts. 8,601
  4. Avatar for Idiotboy 114. Idiotboy Lv 1 24 pts. 8,596
  5. Avatar for backterria 115. backterria Lv 1 24 pts. 8,589
  6. Avatar for NotJim99 116. NotJim99 Lv 1 24 pts. 8,585
  7. Avatar for Glen B 117. Glen B Lv 1 23 pts. 8,582
  8. Avatar for Auntecedent 118. Auntecedent Lv 1 23 pts. 8,572
  9. Avatar for obbo 119. obbo Lv 1 23 pts. 8,571
  10. Avatar for Amphimixus 120. Amphimixus Lv 1 22 pts. 8,570

Comments