Placeholder image of a protein
Icon representing a puzzle

1816: Revisiting Puzzle 109: Pumpkin

Closed since about 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 24, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Mojo Risin' 21. Mojo Risin' 1 pt. 8,397
  2. Avatar for Team China 22. Team China 1 pt. 8,235
  3. Avatar for CHE222 23. CHE222 1 pt. 8,231
  4. Avatar for Czech National Team 24. Czech National Team 1 pt. 8,076
  1. Avatar for EagleGuy 131. EagleGuy Lv 1 19 pts. 8,531
  2. Avatar for rabamino12358 132. rabamino12358 Lv 1 19 pts. 8,530
  3. Avatar for arodrigu 133. arodrigu Lv 1 19 pts. 8,525
  4. Avatar for Synarus 134. Synarus Lv 1 18 pts. 8,521
  5. Avatar for afroboard 135. afroboard Lv 1 18 pts. 8,515
  6. Avatar for altejoh 136. altejoh Lv 1 18 pts. 8,500
  7. Avatar for JFB 238 137. JFB 238 Lv 1 17 pts. 8,498
  8. Avatar for NeLikomSheet 138. NeLikomSheet Lv 1 17 pts. 8,491
  9. Avatar for MinimalTh77 139. MinimalTh77 Lv 1 17 pts. 8,491
  10. Avatar for RockOn 140. RockOn Lv 1 17 pts. 8,484

Comments